PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73728.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 372aa    MW: 41696.8 Da    PI: 6.2728
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73728.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.32.1e-12943724374
        GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                  L+ecA+ v+ g +++a++++  l+ ++s +gdp +R+aay++eALaar+a s+ +ly+al+++ ++   s ++l+a+++++ev+P+++f++++aN aI
  EPS73728.1   4 SLFECATLVHRGAFAKATEMIGALRGRVSISGDPSERIAAYMVEALAARIATSGRGLYRALQCKVQP---SPDRLSAMQVLFEVCPCFRFGFMAANGAI 99 
                 69****************************************************************9...9**************************** PP

        GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp. 198
                 lea   ee+vHi+Dfd++qG Q+ +L+q+La+ ++++p+l++Tgv++pes+      le +g+rL+++A  l+++fef++ va++++ +++++L++++ 
  EPS73728.1 100 LEACRDEEKVHIVDFDVNQGSQYYTLMQTLAQIDGPKPRLKLTGVDDPESVqrAVGGLEIIGRRLEELAGMLHLSFEFRA-VASETALVTPSMLECQQa 197
                 *************************************************99878889***********************.79***************9 PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 +Eal+Vn+++qlh+++desvs+e++rd++L++vksl+Pk+v+vveq++++n+++Fl+rf+ea +yy ++f+sl+a lpr+s++r++vE+++l+r+i n+
  EPS73728.1 198 DEALVVNFAFQLHHMPDESVSTENPRDRLLRMVKSLNPKLVTVVEQDVNTNTAPFLARFAEAYDYYGSVFESLDAALPRDSQDRMNVEKQCLARDIINI 296
                 *************************************************************************************************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 vaceg+er+er e ++kWr+r+++aGF p p+s+++ +++k l+r+++++ y+v +e g+l +gW+d+ L++ SaWr
  EPS73728.1 297 VACEGEERIERYEVAGKWRARMSMAGFVPFPISNRVRAEIKGLIRRYSDR-YKVRDETGALHFGWEDKILIFSSAWR 372
                 ************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.4321353IPR005202Transcription factor GRAS
PfamPF035147.1E-1274372IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
PKASLFECAT LVHRGAFAKA TEMIGALRGR VSISGDPSER IAAYMVEALA ARIATSGRGL  60
YRALQCKVQP SPDRLSAMQV LFEVCPCFRF GFMAANGAIL EACRDEEKVH IVDFDVNQGS  120
QYYTLMQTLA QIDGPKPRLK LTGVDDPESV QRAVGGLEII GRRLEELAGM LHLSFEFRAV  180
ASETALVTPS MLECQQADEA LVVNFAFQLH HMPDESVSTE NPRDRLLRMV KSLNPKLVTV  240
VEQDVNTNTA PFLARFAEAY DYYGSVFESL DAALPRDSQD RMNVEKQCLA RDIINIVACE  300
GEERIERYEV AGKWRARMSM AGFVPFPISN RVRAEIKGLI RRYSDRYKVR DETGALHFGW  360
EDKILIFSSA WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-6143727375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLS8ECQ00.0S8ECQ0_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000639440.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]